PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_303404g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 167aa    MW: 19553 Da    PI: 6.089
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_303404g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-09971302255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yps++e+  LA+ +gL+++q+ +WF N+R ++
  MA_303404g0010  97 WPYPSETEKIALAECTGLDQKQINNWFINQRKRH 130
                     58*****************************985 PP

2ELK43.95e-155071122
             ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                    ELK++LlrKYsgyL+sLkqEF+
  MA_303404g0010 50 ELKDHLLRKYSGYLSSLKQEFM 71
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011882.0E-85071IPR005539ELK domain
PROSITE profilePS5121311.5755070IPR005539ELK domain
PfamPF037895.4E-125071IPR005539ELK domain
PROSITE profilePS5007112.08270133IPR001356Homeobox domain
SuperFamilySSF466895.13E-2072147IPR009057Homeodomain-like
SMARTSM003894.8E-1272137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-2875136IPR009057Homeodomain-like
PfamPF059205.8E-1790129IPR008422Homeobox KN domain
CDDcd000867.58E-1296134No hitNo description
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MSLMCYYFSF IAAENDEKTE GGASSEEVED GSGGETDFQE VDHHAVEDRE LKDHLLRKYS  60
GYLSSLKQEF MKKKKKGKLP KDARQKLLDW WTVHYKWPYP SETEKIALAE CTGLDQKQIN  120
NWFINQRKRH WKPSEDMQLM AMDGQSPHGA TLYVERHLMT EGYHLDC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1060230.0BT106023.1 Picea glauca clone GQ02901_I15 mRNA sequence.
GenBankEF0837320.0EF083732.1 Picea sitchensis clone WS0299_H19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285521.16e-68PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-65KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA9NR061e-114A9NR06_PICSI; Putative uncharacterized protein
TrEMBLQ9ZTC01e-113Q9ZTC0_PICAB; Homeobox protein
TrEMBLQ9ZR901e-113Q9ZR90_PICMA; Homeobox transcription factor SKN2
STRINGVIT_18s0001g08380.t012e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.15e-55KNOTTED-like from Arabidopsis thaliana